- PIN4 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49132
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- PIN4
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: GLVRQLEQFR VQQQASKMPP KGKSGSGKAG KGGAASGSDS ADKKAQGPKG GGNAVKVRHI LCE
- peptidylprolyl cis/trans isomerase, NIMA-interacting 4
- EPVH, PAR14, PAR17, hEPVH, hPar14, hPar17
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- metabolism
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
GLVRQLEQFRVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCE
Specifications/Features
Available conjugates: Unconjugated